Skip to main content

PPR

Enter Protein Fragments e.g. VFTASKLISLYASVNKPKLSAKVFDSVHFKD, "Bead" Patterns e.g. P-P-P or E1-*DYW, PPR Types e.g. DYW or E+ etc. Or any text you like basically. See help at right

Found 109 Species
Species
Number of Proteins
Actinidia chinensis (Kiwi) Taxon 3625
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » Ericales » Actinidiaceae » Actinidia »
808
(from 30 Assemblies)
Aegilops tauschii (Tausch's goatgrass) Taxon 37682
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Pooideae » Triticodae » Triticeae » Triticinae » Aegilops »
608
(from 535 Assemblies)
Amborella trichopoda Taxon 13333
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » basal Magnoliophyta » Amborellales » Amborellaceae » Amborella »
840
(from 161 Assemblies)
Aquilegia coerulea (Rocky mountain columbine) Taxon 218851
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Ranunculales » Ranunculaceae » Thalictroideae » Aquilegia »
846
(from 101 Assemblies)
Arabidopsis lyrata (Lyre-leaved rock-cress) Taxon 59689
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Camelineae » Arabidopsis »
559
(from 14 Assemblies)
Arabidopsis thaliana (Mouse-ear cress) Taxon 3702
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Camelineae » Arabidopsis »
481
(from 5 Assemblies)
Archaeon loki Taxon 1538547
Archaea » Asgard group » Candidatus Lokiarchaeota » Lokiarchaeum »
1
(from 1 Assembly)
Aspergillus fumigatus Taxon 746128
Eukaryota » Fungi » Dikarya » Ascomycota » Pezizomycotina » Eurotiomycetes » Eurotiomycetidae » Eurotiales » Aspergillaceae » Aspergillus »
10
(from 5 Assemblies)
Aureococcus anophagefferens (Harmful bloom alga) Taxon 44056
Eukaryota » Stramenopiles » Pelagophyceae » Pelagomonadales » Aureococcus »
22
(from 9 Assemblies)
Bathycoccus prasinos Taxon 41875
Eukaryota » Viridiplantae » Chlorophyta » prasinophytes » Mamiellophyceae » Mamiellales » Bathycoccaceae » Bathycoccus »
19
(from 14 Assemblies)
Beta vulgaris (Sugar beet) Taxon 161934
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » Caryophyllales » Chenopodiaceae » Betoideae » Beta »
521
(from 172 Assemblies)
Bigelowiella natans (Pedinomonas minutissima) Taxon 227086
Eukaryota » Rhizaria » Cercozoa » Chlorarachniophyceae » Bigelowiella »
99
(from 59 Assemblies)
Brachypodium distachyon (Purple false brome) Taxon 15368
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Pooideae » Brachypodieae » Brachypodium »
492
(from 5 Assemblies)
Brassica napus (Rape) Taxon 3708
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Brassiceae » Brassica »
1139
(from 40 Assemblies)
Brassica oleracea (Wild cabbage) Taxon 3712
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Brassiceae » Brassica »
599
(from 267 Assemblies)
Brassica rapa (Field mustard) Taxon 3711
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Brassiceae » Brassica »
536
(from 23 Assemblies)
Caenorhabditis elegans Taxon 6239
Eukaryota » Metazoa » Ecdysozoa » Nematoda » Chromadorea » Rhabditida » Rhabditoidea » Rhabditidae » Peloderinae » Caenorhabditis »
3
(from 3 Assemblies)
Cajanus cajan (Pigeon pea) Taxon 3821
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Phaseoleae » Cajanus »
603
(from 234 Assemblies)
Capsella rubella (Pink shepherd's purse) Taxon 81985
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Camelineae » Capsella »
481
(from 13 Assemblies)
Capsicum annuum (Bell pepper) Taxon 4072
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Solanales » Solanaceae » Solanoideae » Capsiceae » Capsicum »
618
(from 373 Assemblies)
Carica papaya (Papaya) Taxon 3649
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Caricaceae » Carica »
521
(from 225 Assemblies)
Chlamydomonas reinhardtii Taxon 3055
Eukaryota » Viridiplantae » Chlorophyta » Chlorophyceae » Chlamydomonadales » Chlamydomonadaceae » Chlamydomonas »
13
(from 10 Assemblies)
Chlorella nc64a (Green alga) Taxon 554065
Eukaryota » Viridiplantae » Chlorophyta » Trebouxiophyceae » Chlorellales » Chlorellaceae » Chlorella »
26
(from 14 Assemblies)
Cicer arietinum (Chickpea) Taxon 3827
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Cicereae » Cicer »
767
(from 109 Assemblies)
Citrullus lanatus (Watermelon) Taxon 3654
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Cucurbitales » Cucurbitaceae » Benincaseae » Citrullus »
462
(from 12 Assemblies)
Citrus sinensis (Sweet orange) Taxon 2711
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Sapindales » Rutaceae » Aurantioideae » Citrus »
524
(from 10 Assemblies)
Coffea canephora (Robusta coffee) Taxon 49390
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Gentianales » Rubiaceae » Ixoroideae » Gardenieae complex » Bertiereae - Coffeeae clade » Coffeeae » Coffea »
541
(from 12 Assemblies)
Cucumis melo (Muskmelon) Taxon 3656
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Cucurbitales » Cucurbitaceae » Benincaseae » Cucumis »
459
(from 94 Assemblies)
Cucumis sativus (Cucumber) Taxon 3659
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Cucurbitales » Cucurbitaceae » Benincaseae » Cucumis »
479
(from 46 Assemblies)
Cyanidioschyzon merolae (Red alga) Taxon 45157
Eukaryota » Rhodophyta » Bangiophyceae » Cyanidiales » Cyanidiaceae » Cyanidioschyzon »
10
(from 9 Assemblies)
Cyanophora paradoxa Taxon 2762
Eukaryota » Glaucocystophyceae » Cyanophoraceae » Cyanophora »
32
(from 0 Assembly)
Danio rerio (Zebrafish) Taxon 7955
Eukaryota » Metazoa » Chordata » Craniata » Vertebrata » Euteleostomi » Actinopterygii » Neopterygii » Teleostei » Ostariophysi » Cypriniformes » Cyprinidae » Danio »
7
(from 7 Assemblies)
Dictyostelium discoideum (Slime mold) Taxon 44689
Eukaryota » Amoebozoa » Mycetozoa » Dictyosteliida » Dictyostelium »
13
(from 5 Assemblies)
Drosophila melanogaster (Fruit fly) Taxon 7227
Eukaryota » Metazoa » Ecdysozoa » Arthropoda » Hexapoda » Insecta » Pterygota » Neoptera » Holometabola » Diptera » Brachycera » Muscomorpha » Ephydroidea » Drosophilidae » Drosophila » Sophophora »
4
(from 4 Assemblies)
Ectocarpus siliculosus (Brown alga) Taxon 2880
Eukaryota » Stramenopiles » PX clade » Phaeophyceae » Ectocarpales » Ectocarpaceae » Ectocarpus »
90
(from 68 Assemblies)
Elaeis guineensis (Oil palm) Taxon 51953
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Arecaceae » Arecoideae » Cocoseae » Elaeidinae » Elaeis »
722
(from 130 Assemblies)
Emiliania huxleyi Taxon 2903
Eukaryota » Haptophyceae » Isochrysidales » Noelaerhabdaceae » Emiliania »
71
(from 60 Assemblies)
Entamoeba histolytica Taxon 5759
Eukaryota » Amoebozoa » Archamoebae » Entamoebidae » Entamoeba »
2
(from 2 Assemblies)
Eucalyptus grandis (Flooded gum) Taxon 71139
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Myrtales » Myrtaceae » Myrtoideae » Eucalypteae » Eucalyptus »
670
(from 47 Assemblies)
Fragaria vesca (Woodland strawberry) Taxon 57918
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Rosaceae » Rosoideae » Potentilleae » Fragariinae » Fragaria »
620
(from 139 Assemblies)
Gallus gallus (Chicken) Taxon 9031
Eukaryota » Metazoa » Chordata » Craniata » Vertebrata » Euteleostomi » Archelosauria » Archosauria » Dinosauria » Saurischia » Theropoda » Coelurosauria » Aves » Neognathae » Galloanserae » Galliformes » Phasianidae » Phasianinae » Gallus »
6
(from 6 Assemblies)
Glycine max (Soybean) Taxon 3847
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Phaseoleae » Glycine » Soja »
887
(from 24 Assemblies)
Gossypium arboreum (Tree cotton) Taxon 29729
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Malvales » Malvaceae » Malvoideae » Gossypium »
580
(from 28 Assemblies)
Gossypium raimondii (New World cotton) Taxon 29730
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Malvales » Malvaceae » Malvoideae » Gossypium »
585
(from 87 Assemblies)
Guillardia theta Taxon 55529
Eukaryota » Cryptophyta » Pyrenomonadales » Geminigeraceae » Guillardia »
44
(from 30 Assemblies)
Homo sapiens (Human) Taxon 9606
Eukaryota » Metazoa » Chordata » Craniata » Vertebrata » Euteleostomi » Mammalia » Eutheria » Euarchontoglires » Primates » Haplorrhini » Catarrhini » Hominidae » Homo »
6
(from 4 Assemblies)
Klebsormidium flaccidum (Filamentous green alga) Taxon 3175
Eukaryota » Viridiplantae » Streptophyta » Klebsormidiophyceae » Klebsormidiales » Klebsormidiaceae » Klebsormidium »
64
(from 0 Assembly)
Leishmania infantum Taxon 5671
Eukaryota » Euglenozoa » Kinetoplastida » Trypanosomatidae » Leishmaniinae » Leishmania »
28
(from 18 Assemblies)
Linum usitatissimum (Flax) Taxon 4006
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Malpighiales » Linaceae » Linum »
1016
(from 396 Assemblies)
Lotus japonicus Taxon 34305
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Loteae » Lotus »
541
(from 395 Assemblies)
Malus domestica (Apple) Taxon 3750
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Rosaceae » Maloideae » Maleae » Malus »
1392
(from 1300 Assemblies)
Manihot esculenta (Cassava) Taxon 3983
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Malpighiales » Euphorbiaceae » Crotonoideae » Manihoteae » Manihot »
558
(from 322 Assemblies)
Medicago truncatula (Barrel medic) Taxon 3880
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Trifolieae » Medicago »
695
(from 219 Assemblies)
Micromonas pusilla (Picoplanktonic green alga) Taxon 38833
Eukaryota » Viridiplantae » Chlorophyta » prasinophytes » Mamiellophyceae » Mamiellales » Mamiellaceae » Micromonas »
17
(from 11 Assemblies)
Mimulus guttatus (Yellow monkey flower) Taxon 4155
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Lamiales » Phrymaceae » Erythranthe »
587
(from 175 Assemblies)
Monosiga brevicollis (Choanoflagellate) Taxon 81824
Eukaryota » Choanoflagellida » Craspedida » Salpingoecidae » Monosiga »
5
(from 4 Assemblies)
Morus notabilis (Mulberry) Taxon 981085
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Moraceae » Morus »
565
(from 347 Assemblies)
Mus musculus (Mouse) Taxon 10090
Eukaryota » Metazoa » Chordata » Craniata » Vertebrata » Euteleostomi » Mammalia » Eutheria » Euarchontoglires » Glires » Rodentia » Myomorpha » Muroidea » Muridae » Murinae » Mus » Mus »
8
(from 7 Assemblies)
Musa acuminata (Banana) Taxon 4641
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Zingiberales » Musaceae » Musa »
556
(from 12 Assemblies)
Naegleria gruberi (Amoeba) Taxon 5762
Eukaryota » Heterolobosea » Schizopyrenida » Vahlkampfiidae » Naegleria »
49
(from 29 Assemblies)
Nannochloropsis gaditana Taxon 72520
Eukaryota » Stramenopiles » Eustigmatophyceae » Eustigmatales » Monodopsidaceae » Nannochloropsis »
57
(from 48 Assemblies)
Nelumbo nucifera (Sacred lotus) Taxon 4432
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Proteales » Nelumbonaceae » Nelumbo »
739
(from 416 Assemblies)
Nicotiana sylvestris (Wood tobacco) Taxon 4096
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Solanales » Solanaceae » Nicotianoideae » Nicotianeae » Nicotiana »
552
(from 502 Assemblies)
Oryza sativa (Indica) (Rice) Taxon 39946
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Oryzoideae » Oryzeae » Oryzinae » Oryza » Oryza sativa »
554
(from 15 Assemblies)
Oryza sativa (Japonica) (Rice) Taxon 39947
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Oryzoideae » Oryzeae » Oryzinae » Oryza » Oryza sativa »
510
(from 12 Assemblies)
Ostreococcus tauri Taxon 70448
Eukaryota » Viridiplantae » Chlorophyta » prasinophytes » Mamiellophyceae » Mamiellales » Bathycoccaceae » Ostreococcus »
21
(from 12 Assemblies)
Panicum virgatum (Switchgrass) Taxon 38727
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » PACMAD clade » Panicoideae » Panicodae » Paniceae » Panicinae » Panicum »
1181
(from 1142 Assemblies)
Paramecium tetraurelia Taxon 5888
Eukaryota » Alveolata » Ciliophora » Intramacronucleata » Oligohymenophorea » Peniculida » Parameciidae » Paramecium »
5
(from 4 Assemblies)
Perkinsus marinus Taxon 31276
Eukaryota » Alveolata » Perkinsea » Perkinsida » Perkinsidae » Perkinsus »
15
(from 13 Assemblies)
Phaeodactylum tricornutum (Diatom) Taxon 2850
Eukaryota » Stramenopiles » Bacillariophyta » Bacillariophyceae » Bacillariophycidae » Naviculales » Phaeodactylaceae » Phaeodactylum »
50
(from 26 Assemblies)
Phaseolus vulgaris (Kidney bean) Taxon 3885
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Fabales » Fabaceae » Papilionoideae » Phaseoleae » Phaseolus »
510
(from 13 Assemblies)
Phoenix dactylifera (Date palm) Taxon 42345
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Arecaceae » Coryphoideae » Phoeniceae » Phoenix »
893
(from 365 Assemblies)
Phyllostachys edulis Taxon 38705
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Bambusoideae » Arundinarodae » Arundinarieae » Arundinariinae » Phyllostachys »
887
(from 695 Assemblies)
Physcomitrella patens (Moss) Taxon 3218
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Bryophyta » Bryophytina » Bryopsida » Funariidae » Funariales » Funariaceae » Physcomitrella »
113
(from 91 Assemblies)
Phytophthora infestans (Potato late blight fungus) Taxon 4787
Eukaryota » Stramenopiles » Oomycetes » Peronosporales » Phytophthora »
31
(from 16 Assemblies)
Picea abies (Norway spruce) Taxon 3329
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Pinidae » Pinales » Pinaceae » Picea »
1448
(from 1352 Assemblies)
Plasmodium falciparum Taxon 5833
Eukaryota » Alveolata » Apicomplexa » Aconoidasida » Haemosporida » Plasmodiidae » Plasmodium » Plasmodium (Laverania) »
2
(from 2 Assemblies)
Populus euphratica (Euphrates poplar) Taxon 75702
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Malpighiales » Salicaceae » Saliceae » Populus »
624
(from 293 Assemblies)
Populus trichocarpa (Western balsam poplar) Taxon 3694
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Malpighiales » Salicaceae » Saliceae » Populus »
618
(from 32 Assemblies)
Porphyridium purpureum (Red alga) Taxon 35688
Eukaryota » Rhodophyta » Bangiophyceae » Porphyridiales » Porphyridiaceae » Porphyridium »
47
(from 0 Assembly)
Prunus mume (Japanese apricot) Taxon 102107
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Rosaceae » Maloideae » Amygdaleae » Prunus »
641
(from 40 Assemblies)
Prunus persica (Peach) Taxon 3760
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Rosaceae » Maloideae » Amygdaleae » Prunus »
580
(from 12 Assemblies)
Pyrus x bretschneideri (Chinese white pear) Taxon 225117
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Rosales » Rosaceae » Maloideae » Maleae » Pyrus »
879
(from 108 Assemblies)
Reticulomyxa filosa Taxon 46433
Eukaryota » Rhizaria » Foraminifera » Monothalamids » Reticulomyxidae » Reticulomyxa »
64
(from 64 Assemblies)
Ricinus communis (Castor bean) Taxon 3988
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » fabids » Malpighiales » Euphorbiaceae » Acalyphoideae » Acalypheae » Ricinus »
522
(from 230 Assemblies)
Saccharomyces cerevisiae (Baker's yeast) Taxon 4932
Eukaryota » Fungi » Dikarya » Ascomycota » Saccharomycotina » Saccharomycetes » Saccharomycetales » Saccharomycetaceae » Saccharomyces »
5
(from 5 Assemblies)
Selaginella moellendorffii (Spikemoss) Taxon 88036
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Lycopodiopsida » Selaginellales » Selaginellaceae » Selaginella »
3949
(from 225 Assemblies)
Sesamum indicum (Oriental sesame) Taxon 4182
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Lamiales » Pedaliaceae » Sesamum »
487
(from 35 Assemblies)
Setaria italica (Foxtail millet) Taxon 4555
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » PACMAD clade » Panicoideae » Panicodae » Paniceae » Cenchrinae » Setaria »
549
(from 9 Assemblies)
Solanum lycopersicum (Tomato) Taxon 4081
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Solanales » Solanaceae » Solanoideae » Solaneae » Solanum » Lycopersicon »
497
(from 13 Assemblies)
Solanum tuberosum (Potato) Taxon 4113
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Solanales » Solanaceae » Solanoideae » Solaneae » Solanum »
522
(from 249 Assemblies)
Sorghum bicolor (Sorghum) Taxon 4558
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » PACMAD clade » Panicoideae » Andropogonodae » Andropogoneae » Sorghinae » Sorghum »
501
(from 13 Assemblies)
Spirodela polyrhiza (Giant duckweed) Taxon 29656
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Araceae » Lemnoideae » Spirodela »
559
(from 32 Assemblies)
Symbiodinium minutum Taxon 1202447
Eukaryota » Alveolata » Dinophyceae » Suessiales » Symbiodiniaceae » Symbiodinium »
687
(from 557 Assemblies)
Tarenaya hassleriana (spider flower) Taxon 28532
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Cleomaceae » Tarenaya »
626
(from 89 Assemblies)
Thalassiosira pseudonana (Marine diatom) Taxon 35128
Eukaryota » Stramenopiles » Bacillariophyta » Coscinodiscophyceae » Thalassiosirophycidae » Thalassiosirales » Thalassiosiraceae » Thalassiosira »
38
(from 16 Assemblies)
Theileria annulata Taxon 5874
Eukaryota » Alveolata » Apicomplexa » Aconoidasida » Piroplasmida » Theileriidae » Theileria »
3
(from 3 Assemblies)
Thellungiella parvula Taxon 98039
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Brassicaceae incertae sedis » Schrenkiella »
454
(from 38 Assemblies)
Thellungiella salsuginea (Saltwater cress) Taxon 72664
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Brassicales » Brassicaceae » Eutremeae » Eutrema »
501
(from 147 Assemblies)
Theobroma cacao (Cacao) Taxon 3641
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » malvids » Malvales » Malvaceae » Byttnerioideae » Theobroma »
534
(from 11 Assemblies)
Trichomonas vaginalis Taxon 5722
Eukaryota » Parabasalia » Trichomonadida » Trichomonadidae » Trichomonas »
4
(from 3 Assemblies)
Triticum aestivum (Wheat) Taxon 4565
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Pooideae » Triticodae » Triticeae » Triticinae » Triticum »
1646
(from 1587 Assemblies)
Triticum urartu (Red wild einkorn) Taxon 4572
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » BOP clade » Pooideae » Triticodae » Triticeae » Triticinae » Triticum »
481
(from 438 Assemblies)
Trypanosoma brucei Taxon 5691
Eukaryota » Euglenozoa » Kinetoplastida » Trypanosomatidae » Trypanosoma »
28
(from 11 Assemblies)
Utricularia gibba (Two-flower bladderwort) Taxon 13748
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » asterids » lamiids » Lamiales » Lentibulariaceae » Utricularia »
399
(from 286 Assemblies)
Vitis vinifera (Grape) Taxon 29760
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » eudicotyledons » Gunneridae » Pentapetalae » rosids » Vitales » Vitaceae » Vitis »
632
(from 25 Assemblies)
Volvox carteri (Green alga) Taxon 3067
Eukaryota » Viridiplantae » Chlorophyta » Chlorophyceae » Chlamydomonadales » Volvocaceae » Volvox »
11
(from 9 Assemblies)
Xenopus tropicalis (Western clawed frog) Taxon 8364
Eukaryota » Metazoa » Chordata » Craniata » Vertebrata » Euteleostomi » Amphibia » Batrachia » Anura » Pipoidea » Pipidae » Xenopodinae » Xenopus » Silurana »
8
(from 7 Assemblies)
Zea mays (Maize) Taxon 4577
Eukaryota » Viridiplantae » Streptophyta » Embryophyta » Tracheophyta » Spermatophyta » Magnoliophyta » Liliopsida » Poales » Poaceae » PACMAD clade » Panicoideae » Andropogonodae » Andropogoneae » Tripsacinae » Zea »
661
(from 10 Assemblies)