Skip to main content
P
P
R
Pentatricopeptide Repeat Proteins
OnekP
If you find this resource useful please cite the following:
Bernard Gutmann, Santana Royan, Mareike Schallenberg-Rüdinger, Henning Lenz, Ian R. Castleden, Rose McDowell, Michael A. Vacher, Julian Tonti-Filippini, Charles S. Bond, Volker Knoop, Ian D. Small (2019) “The expansion and diversification of pentatricopeptide repeat RNA editing factors in plants.” Mol. Plant PMID: 31760160 doi: j.molp.2019.11.002
Pentatricopeptide Repeat Proteins

OnekP PPR

Enter Protein Fragments e.g. VFTASKLISLYASVNKPKLSAKVFDSVHFKD, "Bead" Patterns e.g. P-P-P or E1-*DYW, PPR Types e.g. DYW or E+ etc. Or any text you like basically. See help at right

Found 1029 Samples

Page 2 of 11 (1029 rows total)
1kP
Species
Number of Proteins
AALA
Meliosma cuneifolia Taxon 400539
Basal Eudicots» Sabiales» Sabiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Proteales» Sabiaceae» Meliosma»
130
AAXJ
Atriplex prostrata (Spear-leaved orache) Taxon 190330
Core Eudicots» Caryophyllales» Chenopodiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Chenopodiaceae» Chenopodioideae» Atripliceae» Atriplex»
450
ABCD
Racomitrium elongatum Taxon 71396
Mosses» Grimmiales» Grimmiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Bryophyta» Bryophytina» Bryopsida» Dicranidae» Grimmiales» Grimmiaceae» Racomitrium»
91
ABEH
Heliotropium greggii Taxon 1799584
Asterids» Boraginales» Boraginaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Boraginales» Heliotropiaceae» Heliotropium»
271
ABIJ
Selaginella lepidophylla (Resurrection plant) Taxon 59777
Lycophytes» Selaginellales» Selaginellaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Lycopodiopsida» Selaginellales» Selaginellaceae» Selaginella»
1758
ABSS
Sassafras albidum (White sassafras) Taxon 46945
Basal angiosperms» Laurales» Lauraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Magnoliidae» Laurales» Lauraceae» Sassafras»
477
ACFP
Boehmeria nivea (Chinese grass) Taxon 83906
Rosids» Rosales» Urticaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Rosales» Urticaceae» Boehmeria»
64
ACRY
Pteromonas sp. Taxon 52966
Green Algae» Volvocales» Phacotaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Chlorophyceae» Chlamydomonadales» Phacotaceae»
7
ACWS
Araucaria sp. Taxon 25666
Gymnosperms» Pinales» Araucariaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Araucariales» Araucariaceae»
614
AEKF
mixed species Taxon 130972
Green Algae» Zygnematales» Peniaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Zygnemophyceae» Desmidiales»
9
AEPI
Linum leonii Taxon 794874
Rosids» Malpighiales» Linaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Malpighiales» Linaceae» Linum»
508
AEXY
Blasia sp. Taxon 122624
Liverworts» Blasiales» Blasiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Marchantiophyta» Marchantiopsida» Blasiidae» Blasiales» Blasiaceae»
2
AFLV
Xerophyllum asphodeloides Taxon 117929
Monocots» Liliales» Melanthiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Liliales» Melanthiaceae» Xerophyllum»
263
AFQQ
Inula helenium (Elecampane) Taxon 55635
Asterids» Asterales» Asteraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Asterales» Asteraceae» Asteroideae» Inuleae» Inulinae» Inula»
137
AHRN
Cuscuta pentagona (Fiveangled dodder) Taxon 112407
Asterids» Solanales» Convolvulaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Solanales» Convolvulaceae» Cuscuteae» Cuscuta» Grammica» Cuscuta sect. Cleistogrammica»
437
AIGO
Chamaecyparis lawsoniana (Lawson false cypress) Taxon 58030
Gymnosperms» Pinales» Cupressaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Cupressales» Cupressaceae» Chamaecyparis»
333
AIOU
Brugmansia sanguinea Taxon 540794
Asterids» Solanales» Solanaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Solanales» Solanaceae» Solanoideae» Datureae» Brugmansia»
451
AJAU
Helicodictyon planctonicum Taxon 138173
Green Algae» Chaetophorales» Chaetophoraceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Ulvophyceae» Ulotrichales» Helicodictyon»
20
AJFN
Myodocarpus sp. Taxon 127427
Asterids» Apiales» Myodocarpaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Apiales» Myodocarpaceae»
504
AJJE
Terminalia neotaliala Taxon 1799636
Rosids» Myrtales» Combretaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Myrtales» Combretaceae» Terminalia»
226
AJUW
Chloromonas rosae Taxon 51731
Green Algae» Volvocales» Chlamydomonadaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Chlorophyceae» Chlamydomonadales» Chlamydomonadaceae» Chloromonas»
11
AKCR
Parachlorella kessleri (Green alga) Taxon 3074
Green Algae» Chlorellales» Chlorellaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Trebouxiophyceae» Chlorellales» Chlorellales incertae sedis» Parachlorella»
21
AKXB
Phaeomegaceros coriaceus Taxon 405431
Hornworts» Dendrocerotales» Dendrocerotaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Anthocerotophyta» Anthocerotopsida» Dendrocerotidae» Dendrocerotales» Dendrocerotaceae» Phaeomegacerotoideae» Phaeomegaceros»
1958
ALUC
Ipomoea quamoclit (Cypress vine) Taxon 89660
Asterids» Solanales» Convolvulaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Solanales» Convolvulaceae» Ipomoeeae» Ipomoea»
240
ALVQ
Tmesipteris parva Taxon 1498955
Monilophytes» Psilotales» Psilotaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Polypodiopsida» Ophioglossidae» Psilotales» Psilotaceae» Tmesipteris»
530
ALZF
Halochlorococcum marinum Taxon 1799581
Green Algae» Chlorocystidales» Chlorocystidaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Ulvophyceae» Ulotrichales» Chlorocystidaceae» Halochlorococcum»
16
ANON
Leiosporoceros dussii Taxon 263836
Hornworts» Leiosporocerotales» Leiosporocerotaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Anthocerotophyta» Leiosporocerotopsida» Leiosporocerotales» Leiosporocerotaceae» Leiosporoceros»
496
AQFM
Pseudolarix amabilis (Golden larch) Taxon 3355
Gymnosperms» Pinales» Pinaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Pinales» Pinaceae» Pseudolarix»
925
AQGE
Humulus lupulus (European hop) Taxon 3486
Rosids» Rosales» Cannabaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Rosales» Cannabaceae» Humulus»
329
AQZD
Flaveria pringlei Taxon 4226
Asterids» Asterales» Asteraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Asterales» Asteraceae» Asteroideae» Heliantheae alliance» Tageteae» Flaveria»
378
AREG
Nothotsuga longibracteata Taxon 123601
Gymnosperms» Pinales» Pinaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Pinales» Pinaceae» Nothotsuga»
425
ARYD
Oenothera laciniata Taxon 238288
Rosids» Myrtales» Onagraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Myrtales» Onagraceae» Onagroideae» Onagreae» Oenothera»
545
ASMV
Ilex vomitoria (Yaupon holly) Taxon 4297
Asterids» Aquifoliales» Aquifoliaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Aquifoliales» Aquifoliaceae» Ilex»
614
ATFX
Muntingia calabura (Jamaican cherry) Taxon 45164
Rosids» Malvales» Muntingiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Malvales» Muntingiaceae» Muntingia»
508
ATYL
Scutellaria montana Taxon 1799630
Asterids» Lamiales» Lamiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Lamiales» Lamiaceae» Scutellarioideae» Scutellaria»
474
AUDE
Widdringtonia cedarbergensis Taxon 13760
Gymnosperms» Pinales» Cupressaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Cupressales» Cupressaceae» Widdringtonia»
724
AUGV
Capnoides sempervirens (Rock-harlequin) Taxon 3464
Basal Eudicots» Ranunculales» Papaveraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Ranunculales» Papaveraceae» Fumarioideae» Capnoides»
539
AUIP
Phelline lucida Taxon 92224
Asterids» Asterales» Phellinaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Asterales» Phellinaceae» Phelline»
449
AVJK
Cavendishia cuatrecasasii Taxon 1799565
Asterids» Ericales» Ericaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Ericales» Ericaceae» Vaccinioideae» Vaccinieae» Cavendishia»
275
AWJM
Edgeworthia papyrifera Taxon 142181
Rosids» Malvales» Thymelaeaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Malvales» Thymelaeaceae» Edgeworthia»
336
AWOI
Diphyscium foliosum (Nut-moss) Taxon 82928
Mosses» Diphysciales» Diphysciaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Bryophyta» Bryophytina» Bryopsida» Diphysciidae» Diphysciales» Diphysciaceae» Diphyscium»
120
AWQB
Picea engelmannii (Engelmann's spruce) Taxon 3334
Gymnosperms» Pinales» Pinaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Pinales» Pinaceae» Picea»
606
AXAF
Thladiantha villosula Taxon 1045188
Rosids» Cucurbitales» Cucurbitaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Cucurbitales» Cucurbitaceae» Thladiantheae» Thladiantha»
67
AXBO
Sinojackia xylocarpa Taxon 168123
Asterids» Ericales» Styracaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Ericales» Styracaceae» Sinojackia»
125
AXNH
Oenothera filiformis Taxon 260694
Rosids» Myrtales» Onagraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Myrtales» Onagraceae» Onagroideae» Onagreae» Oenothera»
507
AXPJ
Linum flavum Taxon 407263
Rosids» Malpighiales» Linaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Malpighiales» Linaceae» Linum»
52
AYIY
Ruellia brittoniana Taxon 440931
Asterids» Lamiales» Acanthaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Lamiales» Acanthaceae» Acanthoideae» Ruellieae» Ruelliinae» Ruellia»
427
AYMT
Eucalyptus leucoxylon (white ironbark) Taxon 34318
Rosids» Myrtales» Myrtaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Myrtales» Myrtaceae» Myrtoideae» Eucalypteae» Eucalyptus»
121
AZBL
Petiveria alliacea Taxon 46142
Core Eudicots» Caryophyllales» Petiveriaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Petiveriaceae» Petiveria»
398
BAHE
Solenostemon scutellarioides (Coleus) Taxon 4142
Asterids» Lamiales» Lamiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Lamiales» Lamiaceae» Nepetoideae» Ocimeae» Solenostemon»
383
BAZF
Chaetopeltis orbicularis Taxon 56002
Green Algae» Chaetopeltidales» Chaetopeltidaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Chlorophyceae» Chaetopeltidales» Chaetopeltidaceae» Chaetopeltis»
12
BBBA
Tetrastigma obtectum Taxon 345136
Rosids» Vitales» Vitaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» Vitales» Vitaceae» Tetrastigma»
76
BBDD
Lepidothamnus sp. Taxon 120594
Gymnosperms» Pinales» Podocarpaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Araucariales» Podocarpaceae»
333
BCAA
Kirkia wilmsii Taxon 43703
Rosids» Sapindales» Kirkiacae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Sapindales» Rutaceae» Kirkia»
710
BCGB
Cinnamomum camphora (Camphor tree) Taxon 13429
Basal angiosperms» Laurales» Lauraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Magnoliidae» Laurales» Lauraceae» Cinnamomum»
213
BCYF
Chlamydomonas cribrum Taxon 69356
Green Algae» Volvocales» Chlamydomonadaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Chlorophyceae» Chlamydomonadales» Chlamydomonadaceae» Chlamydomonas»
5
BDJQ
Zingiber officinale (Ginger) Taxon 94328
Monocots» Zingiberales» Zingiberaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Zingiberales» Zingiberaceae» Zingiber»
470
BEFC
Manilkara zapota (Sapodilla plum) Taxon 3741
Asterids» Ericales» Sapotaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Ericales» Sapotaceae» Sapotoideae» Manilkara»
553
BEGM
Botrypus virginianus Taxon 167744
Monilophytes» Ophioglossales» Ophioglossaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Polypodiopsida» Ophioglossidae» Ophioglossales» Ophioglossaceae» Botrychioideae» Botrypus»
677
BEKN
Papaver rhoeas (Common poppy) Taxon 33128
Basal Eudicots» Ranunculales» Papaveraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Ranunculales» Papaveraceae» Papaveroideae» Papaver»
703
BERS
Zaleya pentandra Taxon 323199
Core Eudicots» Caryophyllales» Aizoaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Aizoaceae» Zaleya»
370
BFIK
Entransia fimbriata Taxon 130991
Green Algae» Klebsormidiales» Klebsormidiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Zygnemophyceae» Zygnematales» Zygnemataceae» Entransia»
64
BFJL
Cornus florida (Flowering dogwood) Taxon 4283
Asterids» Cornales» Cornaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Cornales» Cornaceae» Cornus»
466
BGXB
Plagiomnium insigne Taxon 259530
Mosses» Bryales» Mielichhoferiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Bryophyta» Bryophytina» Bryopsida» Bryidae» Bryanae» Bryales» Mniaceae» Plagiomnium»
95
BGZG
Cissus quadrangularis (Veldt grape) Taxon 165298
Rosids» Vitales» Vitaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» Vitales» Vitaceae» Cissus»
289
BHBK
Cosmarium tinctum Taxon 485969
Green Algae» Zygnematales» Desmidiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Zygnemophyceae» Desmidiales» Desmidiaceae» Cosmarium»
31
BHYC
Linum lewisii Taxon 586382
Rosids» Malpighiales» Linaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Malpighiales» Linaceae» Linum»
475
BIDT
Flaveria cronquistii (Yellowtops) Taxon 29717
Asterids» Asterales» Asteraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Asterales» Asteraceae» Asteroideae» Heliantheae alliance» Tageteae» Flaveria»
418
BILC
Prototheca wickerhamii Taxon 3111
Green Algae» Chlorellales» Chlorellaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» Trebouxiophyceae» Chlorellales» Chlorellaceae» Prototheca»
6
BJKT
Delosperma echinatum (Pickle cactus) Taxon 85190
Core Eudicots» Caryophyllales» Aizoaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Aizoaceae» Delosperma»
157
BJSW
Cannabis sativa (Hemp) Taxon 3483
Rosids» Rosales» Cannabaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Rosales» Cannabaceae» Cannabis»
603
BKQU
Phytolacca americana (American pokeweed) Taxon 3527
Core Eudicots» Caryophyllales» Phytolaccaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Phytolaccaceae» Phytolacca»
304
BLAJ
Hemerocallis spp. Taxon 16107
Monocots» Asparagales» Hemerocallidaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Asparagales» Asphodelaceae» Hemerocallidoideae»
281
BLVL
Sorbus koehneana Taxon 691237
Rosids» Rosales» Rosaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Rosales» Rosaceae» Maloideae» Maleae» Sorbus»
59
BLWH
Portulaca umbraticola Taxon 860317
Core Eudicots» Caryophyllales» Portulacaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Cactineae» Portulacaceae» Portulaca»
325
BMIF
Odontosororia sp. Taxon 1799605
Monilophytes» Polypodiales» Lindsaeaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Polypodiopsida» Polypodiidae» Polypodiales» Lindsaeineae» Lindsaeaceae» Odontosoria»
2042
BMJR
Adiantum raddianum (Maidenhair fern) Taxon 32168
Monilophytes» Polypodiales» Pteridaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Polypodiopsida» Polypodiidae» Polypodiales» Pteridineae» Pteridaceae» Vittarioideae» Adiantum»
1724
BMSE
Senecio rowleyanus Taxon 189246
Asterids» Asterales» Asteraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» campanulids» Asterales» Asteraceae» Asteroideae» Senecioneae» Senecioninae» Curio»
191
BNCU
Radula lindenbergiana Taxon 697108
Liverworts» Porellales» Radulaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Marchantiophyta» Jungermanniopsida» Jungermanniidae» Porellales» Radulineae» Radulaceae» Radula»
130
BNDE
Hypericum perforatum (St. John's wort) Taxon 65561
Rosids» Malpighiales» Hypericaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Malpighiales» Hypericaceae» Hypericeae» Hypericum»
421
BNTL
Souroubea exauriculata Taxon 164987
Asterids» Ericales» Marcgraviaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Ericales» Marcgraviaceae» Souroubea»
591
BOLZ
Atropa belladonna (Belladonna) Taxon 33113
Asterids» Solanales» Solanaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» lamiids» Solanales» Solanaceae» Solanoideae» Hyoscyameae» Atropa»
468
BPKH
Neurachne annularis Taxon 1198659
Monocots» Poales» Poaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Poales» Poaceae» PACMAD clade» Panicoideae» Panicodae» Paniceae» Neurachninae» Neurachne»
485
BPSG
Scouleria aquatica Taxon 67421
Mosses» Grimmiales» Scouleriaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Bryophyta» Bryophytina» Bryopsida» Dicranidae» Scouleriales» Scouleriaceae» Scouleria»
150
BRUD
Typha latifolia (Bulrush) Taxon 4733
Monocots» Poales» Typhaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Poales» Typhaceae» Typha»
240
BSEY
Daenikera sp. Taxon 450000
Core Eudicots» Santalales» Santalaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Santalales» Amphorogynaceae»
509
BSNI
Anthoceros agrestis Taxon 41834
Hornworts» Anthocerotales» Anthoceroceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Anthocerotophyta» Anthocerotopsida» Anthocerotidae» Anthocerotales» Anthocerotaceae» Anthoceros»
1609
BSTR
Chondropetalum tectorum Taxon 311269
Monocots» Poales» Restionaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Poales» Restionaceae» Elegia»
246
BSVG
Gyrocarpus americanus Taxon 63807
Basal angiosperms» Laurales» Hernandiaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Magnoliidae» Laurales» Hernandiaceae» Gyrocarpus»
864
BTFM
Monomastix opisthostigma Taxon 687946
Green Algae» Mamiellales» Monomasticaceae» NCBI: Eukaryota» Viridiplantae» Chlorophyta» prasinophytes» Mamiellophyceae» Monomastigales» Monomastigaceae» Monomastix»
10
BTTS
Austrotaxus spicata Taxon 89478
Gymnosperms» Pinales» Taxaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Cupressales» Taxaceae» Austrotaxus»
418
BTZX
Philadelphus inodorus Taxon 23114
Asterids» Cornales» Hydrangeaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» asterids» Cornales» Hydrangeaceae» Philadelphus»
186
BUWV
Platycladus orientalis Taxon 58046
Gymnosperms» Pinales» Cupressaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Pinidae» Cupressales» Cupressaceae» Platycladus»
464
BVOF
Linum perenne (Perennial flax) Taxon 35941
Rosids» Malpighiales» Linaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» fabids» Malpighiales» Linaceae» Linum»
524
BWRK
Alternanthera sessilis Taxon 221762
Core Eudicots» Caryophyllales» Amaranthaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» Caryophyllales» Amaranthaceae» Alternanthera»
476
BWVJ
Betaphycus philippinensis Taxon 88415
Red Algae» Gigartinales» Solieriaceae» NCBI: Eukaryota» Rhodophyta» Florideophyceae» Gigartinales» Solieriaceae» Betaphycus»
15
BXAY
Neurachne minor Taxon 1198660
Monocots» Poales» Poaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Poales» Poaceae» PACMAD clade» Panicoideae» Panicodae» Paniceae» Neurachninae» Neurachne»
291
BYPY
Brocchinia reducta Taxon 230702
Monocots» Poales» Bromeliaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Poales» Bromeliaceae» Brocchinioideae» Brocchinia»
438
BYQM
Posidonia australis Taxon 55488
Monocots» Alismatales» Posidoniaceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» Liliopsida» Posidoniaceae» Posidonia»
561
BZDF
Oenothera biennis (German evening primrose) Taxon 3942
Rosids» Myrtales» Onagraceae» NCBI: Eukaryota» Viridiplantae» Streptophyta» Embryophyta» Tracheophyta» Spermatophyta» Magnoliophyta» eudicotyledons» Gunneridae» Pentapetalae» rosids» malvids» Myrtales» Onagraceae» Onagroideae» Onagreae» Oenothera»
584
Page 2 of 11 (1029 rows total)